SEGUID Header
  ::HOME    ::OVERVIEW    ::TOOLS    ::SOAP-Match    ::WEB SERVICES    ::FTP    ::HELP 
Create a FASTA file for a given species

Create a FASTA file compatible with BLAST by the combination of sequence information, annotation , and taxonomy data. 
>gnl|sha|+jePZptioMi9rcl+OG5AkCLxHac|ferulate decarboxylase [Bacillus pumilus]
MDQFVGLHMIYTYENGWEYEIYIKNDHTIDYRIHSGMVGGRWVRDQEVNIVKLTKGVYKV
SWTEPTGTDVSLNFMPEEKRMHGVIFFPKWVHERPDITVCYQNDYIDLMKESREKYETYP
KYVVPEFADITYIHHAGVNDETIIAEAPYEGMTDEIRAGRK
>gnl|sha|06uKRmMhGXMsFvnjO5m6ufMMUKM|ferulic acid decarboxylase
MDQFVGLHMLYTYENKWEYEIYIKNDHTIDYRIHSGMVG
Create an alias table for a given species

Create an Excel sheet of aliases by the combination of annotation and taxonomy data using all available database sources.

Display annotation table for a set of SEGUIDs

Provide a list of SEGUID identifiers (separated by new line):
(give/clear an example)
Display FASTA file for a set of SEGUIDs

Provide a list of SEGUID identifiers (separated by new line):
(give/clear an example)
Display FASTA file for a set of SEGUIDs (with region information)

Provide a list of SEGUID identifiers and regions (regions separated by tab and entries separated by new line):
(give/clear an example)
  Obtain protein properties calculated from sequence information

  Create SEGUIDs from FASTA file

  SEGUID database statistics for a given organism

  Create SEGUIDs from a list of GI#

  Create SEGUIDs from a list of DBACCESSION1 identifiers
(e.g. Q8EKT8 (UNITREMBL), AAN53088.1 (gb), NP_715644.1 (ref), SO0001 (TIGR), son:SO0001 (KEGG), Q8CX52 (UNISP), etc.)

  Create SEGUIDs from a list of DBACCESSION2 identifiers
(e.g. 1B38_HUMAN (UNIPROT), ACIAD3213 (TIGR), Ereg (KEGG), ND1_11653 (ref), etc.)

  Get SEGUIDs from first 3 letters of SEGUID

Operated by the   University of Chicago   for the   U.S. Department of Energy  
This is a Federal computer (see   Security Notice  ). For condition of use, see   ANL Disclaimer  .

last modified: